Mouse Anti-Cattle CPSF1 Antibody (MO-AB-10684R)


Cat: MO-AB-10684R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10684R
SpecificityThis antibody binds to Cattle CPSF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCPSF1 (Cleavage And Polyadenylation Specific Factor 1) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway and RNA Polymerase II Transcription Termination. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and mRNA 3-UTR binding.
Product OverviewMouse Anti-Cattle CPSF1 Antibody is a mouse antibody against CPSF1. It can be used for CPSF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCleavage and polyadenylation specificity factor subunit 1; Cleavage and polyadenylation specificity factor 160 kDa subunit; CPSF 160 kDa subunit; CPSF1; CPSF160
UniProt IDQ10569
Protein RefseqThe length of the protein is 1444 amino acids long.
The sequence is show below: MYAVYKQAHPPTGLEFSMYCNFFNNSERNLVVAGTSQLYVYRLNRDSEAPTKNDRSTDGKAHREHREKLELVASFSFFGNVMSMASVQLAGAKRDALLLSFKDAKLSVVEYDPGTHDLKTLSLHYFEEPELRDGFVQNVHTPRVRVDPDGRCAAMLIYGTRLVVLPFRRESLAEEHEGLVGEGQRSSFLPSYIIDVRALDEKLLNIVDLQFLHGYYEPTLLILFEPNQTWPGRVAVRQDTCSIVAISLNITQKVH.
For Research Use Only | Not For Clinical Use.
Online Inquiry