Mouse Anti-Cattle CRLS1 Antibody (MO-AB-10746R)


Cat: MO-AB-10746R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10746R
SpecificityThis antibody binds to Cattle CRLS1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCRLS1 (Cardiolipin Synthase 1) is a Protein Coding gene. Diseases associated with CRLS1 include Catastrophic Antiphospholipid Syndrome. Among its related pathways are Metabolism and Glycerophospholipid biosynthesis. Gene Ontology (GO) annotations related to this gene include phosphotransferase activity, for other substituted phosphate groups and CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase activity.
Product OverviewMouse Anti-Cattle CRLS1 Antibody is a mouse antibody against CRLS1. It can be used for CRLS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCRLS1 protein; CRLS1
UniProt IDA5PJS7
Protein RefseqThe length of the protein is 302 amino acids long.
The sequence is show below: MLASRMARASWGALRVAAWAPGARPGKGRARGALLPPAPGCLGFLAERWWLRPAALGLRLPGASPRAHCSGAEKATPGPATGEDATVEARRGQWGPTSASNLYENPWTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARNWASQKSALGSALDPLADKILISILYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLSKYFNPCYATARLKPTFISKVNTAVQLILVAA.
See other products for " CRLS1 "
MO-AB-19656WMouse Anti-Chimpanzee CRLS1 Antibody (MO-AB-19656W)
CBMOAB-39907FYAMouse Anti-Rhesus CRLS1 Antibody (CBMOAB-39907FYA)
CBMOAB-02188HCBMouse Anti-C. elegans CRLS1 Antibody (CBMOAB-02188HCB)
CBMOAB-71746FYAMouse Anti-Zebrafish crls1 Antibody (CBMOAB-71746FYA)
MO-AB-02655HMouse Anti-Frog crls1 Antibody (MO-AB-02655H)
MO-AB-53571WMouse Anti-Marmoset CRLS1 Antibody (MO-AB-53571W)
For Research Use Only | Not For Clinical Use.
Online Inquiry