Mouse Anti-Cattle CSNK2B Antibody (MO-AB-10857R)


Cat: MO-AB-10857R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10857R
SpecificityThis antibody binds to Cattle CSNK2B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCSNK2B (Casein Kinase 2 Beta) is a Protein Coding gene. Diseases associated with CSNK2B include Autosomal Dominant Non-Syndromic Intellectual Disability and Egg Allergy. Among its related pathways are Mitotic Prometaphase and Mitophagy - animal. Gene Ontology (GO) annotations related to this gene include identical protein binding and receptor binding.
Product OverviewMouse Anti-Cattle CSNK2B Antibody is a mouse antibody against CSNK2B. It can be used for CSNK2B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCasein kinase II subunit beta; CK II beta; Phosvitin; CSNK2B; CK2N
UniProt IDP67868
Protein RefseqThe length of the protein is 215 amino acids long.
The sequence is show below: MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR.
For Research Use Only | Not For Clinical Use.
Online Inquiry