Mouse Anti-Cattle CYP26A1 Antibody (MO-AB-11042R)


Cat: MO-AB-11042R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11042R
SpecificityThis antibody binds to Cattle CYP26A1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP26A1 (Cytochrome P450 Family 26 Subfamily A Member 1) is a Protein Coding gene. Diseases associated with CYP26A1 include Acute Promyelocytic Leukemia and Mixed Germ Cell Cancer. Among its related pathways are Metabolism and Cytochrome P450 - arranged by substrate type. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP26C1.
Product OverviewMouse Anti-Cattle CYP26A1 Antibody is a mouse antibody against CYP26A1. It can be used for CYP26A1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYP26A1 protein; CYP26A1
UniProt IDA6QPJ8
Protein RefseqThe length of the protein is 428 amino acids long.
The sequence is show below: MKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVIMQAFSREALQCYVPVIAEEVGNYLEQWLSCGERGLLVYPQVKRLMFRIAMRILLGCESRLASGGEDEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGLKARDLIHARIEENIRAKIRRLPAAEAGGGCKDALQLLIEHSWERGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry