Mouse Anti-Cattle CYP2J2 Antibody (MO-AB-11054R)


Cat: MO-AB-11054R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11054R
SpecificityThis antibody binds to Cattle CYP2J2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP2J2 (Cytochrome P450 Family 2 Subfamily J Member 2) is a Protein Coding gene. Diseases associated with CYP2J2 include Clopidogrel Resistance. Among its related pathways are Metabolism and Arachidonic acid metabolism. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP2D6.
Product OverviewMouse Anti-Cattle CYP2J2 Antibody is a mouse antibody against CYP2J2. It can be used for CYP2J2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome P450, family 2, subfamily J, polypeptide 2; CYP2J2
UniProt IDQ2TBK1
Protein RefseqThe length of the protein is 502 amino acids long.
The sequence is show below: MLEALGSLVAALWTTLRPGIVLLGAFVFLLFADFLKRQHPKNYPPGPLRLPFIGNFFHLDLGKGILVPQQVVKKYGNIIRLNFGVIHFIVITGLPYIKEALVNQEQNFVNRPMIPLQKHIFNNKGLVRSNGQVWKEQRRFTLTTLRNFGLGRKSLEERIQEEVTYLIQAIGEENGQPFDPHFIINNAVSNIICSITFGERFDYKDDQFQELLRLLDEILCIQASVCCQLYNAFPRIMNFLPGSHHTLFRKWEKLK.
For Research Use Only | Not For Clinical Use.
Online Inquiry