Mouse Anti-Cattle DBP Antibody (MO-AB-11199R)


Cat: MO-AB-11199R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11199R
SpecificityThis antibody binds to Cattle DBP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the PAR bZIP transcription factor family and binds to specific sequences in the promoters of several genes, such as albumin, CYP2A4, and CYP2A5. The encoded protein can bind DNA as a homo- or heterodimer and is involved in the regulation of some circadian rhythm genes.
Product OverviewMouse Anti-Cattle DBP Antibody is a mouse antibody against DBP. It can be used for DBP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesD site-binding protein; Albumin D box-binding protein; Albumin D-element-binding protein; DBP
UniProt IDQ32PF6
Protein RefseqThe length of the protein is 325 amino acids long.
The sequence is show below: MARPVSERTPAPLLLGGPTGAPPGGGALLGLRSLLQGTSKPKEPTSCLLKEKERKASPPAATVPGPGLETAGPADASAGAVVGGGSPRGRPGAAPGPGLLAPLLWERTLPFGDVEYVDLDAFLLEHGLPPSPPPPGGPSPAPSPVRTPAPSPRPGSCGSASPRSSPGHAPARAALGAAGGHRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKIQVPEEQKD.
For Research Use Only | Not For Clinical Use.
Online Inquiry