Mouse Anti-Cattle DBR1 Antibody (MO-AB-11201R)


Cat: MO-AB-11201R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11201R
SpecificityThis antibody binds to Cattle DBR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an RNA lariat debranching enzyme that hydrolyzes 2''-5'' prime branched phosphodiester bonds. The encoded protein specifically targets the bonds at the branch point of excised lariat intron RNA, converting them to linear molecules that are then degraded. This protein may also be involved in retroviral replication. [provided by RefSeq, Nov 2011]
Product OverviewMouse Anti-Cattle DBR1 Antibody is a mouse antibody against DBR1. It can be used for DBR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDBR1 protein; DBR1
UniProt IDA5PJS3
Protein RefseqThe length of the protein is 544 amino acids long.
The sequence is show below: MRVAVAGCCHGELDKIYETLALAERRGPGRIDLLLCCGDFQAVRNEADLRCMAVPPKYRHMQTFYRYYSGEKKAPVLTIFIGGNHEASNHLQELPYGGWVAPNIYYLGLAGVVKYRGVRIGGISGIFKSHDYRKGHFECPPYNAATVRSIYHVRNIEVYKLKQLKQPMDIFLSHDWPRSIYHYGNKKQLLKTKSFFRQEVENNTLGSPAASELLEHLKPTYWFSAHLHVKFAALMQHQTMDKGQSTKATKFLALD.
For Research Use Only | Not For Clinical Use.
Online Inquiry