Mouse Anti-Cattle DCD Antibody (MO-AB-11215R)


Cat: MO-AB-11215R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11215R
SpecificityThis antibody binds to Cattle DCD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis antimicrobial gene encodes a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-terminal peptide, also known as diffusible survival evasion peptide, promotes neural cell survival under conditions of severe oxidative stress. A glycosylated form of the N-terminal peptide may be associated with cachexia (muscle wasting) in cancer patients. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Cattle DCD Antibody is a mouse antibody against DCD. It can be used for DCD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDermcidin; DCD
UniProt IDA0A024FCL2
Protein RefseqThe length of the protein is 112 amino acids long.
The sequence is show below: MRLTAPLLLAALAAALECARGCLCPRIERKGFMKSHALEQNKEKGCSGLEAEQGKGKGRKLCIKSPLQTPPSPPWESGACPAPFPQLPSFQLPVLSSQTPLAPFTPVGGQMF.
For Research Use Only | Not For Clinical Use.
Online Inquiry