Mouse Anti-Cattle DDC Antibody (MO-AB-11259R)


Cat: MO-AB-11259R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11259R
SpecificityThis antibody binds to Cattle DDC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe encoded protein catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. Defects in this gene are the cause of aromatic L-amino-acid decarboxylase deficiency (AADCD). AADCD deficiency is an inborn error in neurotransmitter metabolism that leads to combined serotonin and catecholamine deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jun 2011]
Product OverviewMouse Anti-Cattle DDC Antibody is a mouse antibody against DDC. It can be used for DDC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAromatic-L-amino-acid decarboxylase; AADC; EC 4.1.1.28; DOPA decarboxylase; DDC; DDC
UniProt IDP27718
Protein RefseqThe length of the protein is 487 amino acids long.
The sequence is show below: MNASEFRRRGKEMVDYVADYLEGIEGRQVFPDVDPGYLRPLIPTTAPQEPETFEAIIEDIEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLQLPEAFLAGEAGEGGGVIQGTASEATLVALLAARTKVTRHLQAASPELMQAAIMEKLVAYASDQAHSSVEKAGLIGGVRLKAIPSDGKFAMRASALQEALERDKAAGLIPFFVVATLGTTSCCSFDNLL.
See other products for " DDC "
MO-AB-05538YMouse Anti-A. aegpti DDC Antibody (MO-AB-05538Y)
CBMOAB-14675FYAMouse Anti-D. melanogaster Ddc Antibody (CBMOAB-14675FYA)
MO-AB-02911HMouse Anti-Frog ddc Antibody (MO-AB-02911H)
CBMOAB-73126FYAMouse Anti-Zebrafish ddc Antibody (CBMOAB-73126FYA)
CBMOAB-40523FYAMouse Anti-Rhesus DDC Antibody (CBMOAB-40523FYA)
MO-AB-00384RMouse Anti-Medaka Ddc Antibody (MO-AB-00384R)
MOFAB-806WRabbit Anti-DDC Antibody (MOFAB-806W)
MO-AB-41548WMouse Anti-Guinea pig DDC Antibody (MO-AB-41548W)
For Research Use Only | Not For Clinical Use.
Online Inquiry