Mouse Anti-Cattle DYRK3 Antibody (MO-AB-11770R)


Cat: MO-AB-11770R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11770R
SpecificityThis antibody binds to Cattle DYRK3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine / threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product OverviewMouse Anti-Cattle DYRK3 Antibody is a mouse antibody against DYRK3. It can be used for DYRK3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDYRK3 protein; DYRK3
UniProt IDA6QQN9
Protein RefseqThe length of the protein is 587 amino acids long.
The sequence is show below: MGGTARGPGRKDEGPPGAALPPQQRRLGDGVYDTFMMIDETKCPPCSNVPCNPSEPPLPRRLNITTEHLTRDPTQRFLNGGEMKVEQLFQDFSNRRADNLQSDGVNDSEKCSPTASQGKSSDSLNTVKSSSSSKASKAVPLTPEQALKQYKHHLTAYEKLEIVNYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGSYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIR.
For Research Use Only | Not For Clinical Use.
Online Inquiry