Mouse Anti-Cattle EIF5B Antibody (MO-AB-11950R)


Cat: MO-AB-11950R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11950R
SpecificityThis antibody binds to Cattle EIF5B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAccurate initiation of translation in eukaryotes is complex and requires many factors, some of which are composed of multiple subunits. The process is simpler in prokaryotes which have only three initiation factors (IF1, IF2, IF3). Two of these factors are conserved in eukaryotes: the homolog of IF1 is eIF1A and the homolog of IF2 is eIF5B. This gene encodes eIF5B. Factors eIF1A and eIF5B interact on the ribosome along with other initiation factors and GTP to position the initiation methionine tRNA on the start codon of the mRNA so that translation initiates accurately.
Product OverviewMouse Anti-Cattle EIF5B Antibody is a mouse antibody against EIF5B. It can be used for EIF5B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEukaryotic translation initiation factor 5B; EIF5B
UniProt IDQ32LD6
Protein RefseqThe length of the protein is 116 amino acids long.
The sequence is show below: MGKKQKNKNEDSAKDDIDLDALAAEIEGAGAAREQEPQKAKGKKKKEKKRQDFDEDDILKELEELSWEAQGIKADREPAAVKPTENNEDEPISKQDKKKKGQKGKKQSFEDNDSEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry