Mouse Anti-Cattle ELK3 Antibody (MO-AB-11965R)


Cat: MO-AB-11965R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO11965R
SpecificityThis antibody binds to Cattle ELK3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. This protein is activated by signal-induced phosphorylation; studies in rodents suggest that it is a transcriptional inhibitor in the absence of Ras, but activates transcription when Ras is present. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]
Product OverviewMouse Anti-Cattle ELK3 Antibody is a mouse antibody against ELK3. It can be used for ELK3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesELK3, ETS-domain protein; SRF accessory protein 2; ELK3
UniProt IDA2VDT5
Protein RefseqThe length of the protein is 402 amino acids long.
The sequence is show below: MESAITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYYYDKNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSECKVPPEGREAHRHGLSALKSASRNEYIHSGLYSSFTINSLQNPPEPLKAIKTEKLEEQLEDSPPAEEVRTVIRFVTNKTDKHVSRPVVSLPSTSEAFLASSVSAKISSLMLPNAASISSASPSSSRSPSLSPNSPLPSEHRSLF.
For Research Use Only | Not For Clinical Use.
Online Inquiry