Mouse Anti-Cattle EME1 Antibody (MO-AB-12009R)


Cat: MO-AB-12009R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO12009R
SpecificityThis antibody binds to Cattle EME1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that complexes with methyl methanesulfonate-sensitive UV-sensitive 81 protein to form an endonuclease complex. The encoded protein interacts with specifc DNA structures including nicked Holliday junctions, 3''-flap structures and aberrant replication fork structures. This protein may be involved in repairing DNA damage and in maintaining genomic stability. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Cattle EME1 Antibody is a mouse antibody against EME1. It can be used for EME1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEME1 protein; EME1
UniProt IDA6QQB5
Protein RefseqThe length of the protein is 421 amino acids long.
The sequence is show below: MAVNKSSLSLDSSYSDSEELPTFAFLKNKPSSIKRRHPQEDEKIVVVDISDSEASCPSPKLKDPPPIPEAAETVIQTEPVSVLSSGSENEEEFMPLAKRLICKFLTHKQQSPEKSSSPFERVWDHQKASHDWQKQPFTKIRDVPLCGTSERHASNNKDPVVDSPCHQLPAYQTTCSVQSNSLTITKTNAEVPLPQKRRKYSQKVQKSSTQGCQQWGRASQKESTQRQQEGKKKAALVNRLKAQRPEECLKHIVVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry