Mouse Anti-Cattle FER Antibody (MO-AB-12488R)


Cat: MO-AB-12488R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO12488R
SpecificityThis antibody binds to Cattle FER.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Cytosol; Cytoskeleton; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis protein can bind epidermal growth factor receptor and ATP, and has non-membrane spanning protein tyrosine kinase activity. It participates in many biological processes, including actin cytoskeleton reorganization, blood vessel development, cell adhesion, cell differentiation, convergent extension involved in gastrulation, erythrocyte development, peptidyl-tyrosine autophosphorylation, positive regulation of cell migration, positive regulation of NF-kappaB transcription factor Activity, regulation of cell population proliferation, regulation of epidermal growth factor receptor signaling pathway, regulation of mast cell degranulation and transmembrane receptor protein tyrosine kinase signaling pathway.
Product OverviewMouse Anti-Cattle FER Antibody is a mouse antibody against FER. It can be used for FER detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTyrosine-protein kinase; EC 2.7.10.2; FER
UniProt IDE1BNE0
Protein RefseqThe length of the protein is 822 amino acids long.
The sequence is show below: MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTIQMNYVSNVSKSWLLMIQQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKTSYRQLIKEMNSAKEKYKEAVAKGKETEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDTTLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQID.
For Research Use Only | Not For Clinical Use.
Online Inquiry