Mouse Anti-Cattle GAS8 Antibody (MO-AB-12908R)


Cat: MO-AB-12908R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO12908R
SpecificityThis antibody binds to Cattle GAS8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Golgi apparatus; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle GAS8 Antibody is a mouse antibody against GAS8. It can be used for GAS8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGrowth arrest-specific protein 8; GAS-8; GAS8
UniProt IDA5D7M3
Protein RefseqThe length of the protein is 478 amino acids long.
The sequence is show below: MAPKKKGKKGKGKGTPIVDGLAPEDMSKEQVEEHIGRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQSSLTEMKAEGTVVMKLAQKEHRAQEGTLRRDMRALKVELKEQELANEVMVKNLRLKHTEEITKMRNDFERQVREIEAKYDKKMKMLRDELDLRRKTEIHEVEERKNGQITTLMQRHEEAFTDIKNYYNDITLNNLALINSLKEQM.
For Research Use Only | Not For Clinical Use.
Online Inquiry