Mouse Anti-Cattle GSS Antibody (MO-AB-13395R)


Cat: MO-AB-13395R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO13395R
SpecificityThis antibody binds to Cattle GSS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the formation of an amide bond between glutathione (GSH) and spermidine coupled with hydrolysis of ATP; also catalyzes the opposing reaction, i.e. the hydrolysis of glutathionylspermidine (Gsp) back to glutathione and spermidine. The amidase active site can also hydrolyze Gsp-disulfide (Gsp-S-S-Gsp) to Gsp-SG and Gsp S-thiolated proteins (GspSSPs) to GSH S-thiolated protein (GSSPs). Likely acts synergistically with glutaredoxin to regulate the redox environment of E.coli and defend against oxidative damage. In vitro, the amidase active site also catalyzes hydrolysis of amide and ester derivatives of glutathione (e.g. glutathione ethyl ester and glutathione amide) but lacks activity toward acetylspermidine (N1 and N8) and acetylspermine (N1).
Product OverviewMouse Anti-Cattle GSS Antibody is a mouse antibody against GSS. It can be used for GSS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione synthetase; GSH synthetase; GSH-S; EC 6.3.2.3; Glutathione synthase; GSS
UniProt IDQ5EAC2
Protein RefseqThe length of the protein is 474 amino acids long.
The sequence is show below: MATGWGSLLQDEQQLEELARQAVDRALAEGVLLRTSQAPSSSHVVSYAPFTLFPSPVPSALLEQAYAVQADFNLLVDAVSQNAVFLEQTLSSTIKRDSFTARLFDIHKQVLKEGIAQTVFLGLNRSDYMFQCNPDGSAALKQIEINTVSASFGGLASRTPAVHRHVLSVLGKTKEAAKILSNNPSKGLAMGIAKAWELYGSANAQVLLIAQEKERNIFDQRAIENELLARNIHVIRRKFEDVSEKGSLDQDRRLF.
For Research Use Only | Not For Clinical Use.
Online Inquiry