Mouse Anti-Cattle HDAC5 Antibody (MO-AB-13595R)


Cat: MO-AB-13595R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO13595R
SpecificityThis antibody binds to Cattle HDAC5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the class II histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. It coimmunoprecipitates only with HDAC3 family member and might form multicomplex proteins. It also interacts with myocyte enhancer factor-2 (MEF2) proteins, resulting in repression of MEF2-dependent genes. This gene is thought to be associated with colon cancer. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle HDAC5 Antibody is a mouse antibody against HDAC5. It can be used for HDAC5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone deacetylase; EC 3.5.1.98; HDAC5
UniProt IDF1MNA5
Protein RefseqThe length of the protein is 1125 amino acids long.
The sequence is show below: MNSPTESDGMPGREPALEILPRTPLHGIPVTVEVKPVLPGAMPSSMGGGGGGSPSPVELRGALAGPVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKVSVGARAPRQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIASTEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGTHHASLDQSSPPQSGPPGTPSSYKLPLLGPYDSRDDFPLR.
For Research Use Only | Not For Clinical Use.
Online Inquiry