Mouse Anti-Cattle HERC4 Antibody (MO-AB-13624R)


Cat: MO-AB-13624R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO13624R
SpecificityThis antibody binds to Cattle HERC4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]).
Product OverviewMouse Anti-Cattle HERC4 Antibody is a mouse antibody against HERC4. It can be used for HERC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHect domain and RLD 4; HERC4
UniProt IDQ08DB6
Protein RefseqThe length of the protein is 853 amino acids long.
The sequence is show below: MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKKVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLLGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGIDCKKQASPQLIKSLLGIPFMQIAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDENDRYVPNLLKSLRTQKIVYICCGEDHTA.
For Research Use Only | Not For Clinical Use.
Online Inquiry