Mouse Anti-Cattle ICAM3 Antibody (MO-AB-13929R)


Cat: MO-AB-13929R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO13929R
SpecificityThis antibody binds to Cattle ICAM3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is constitutively and abundantly expressed by all leucocytes and may be the most important ligand for LFA-1 in the initiation of the immune response. It functions not only as an adhesion molecule, but also as a potent signalling molecule. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Cattle ICAM3 Antibody is a mouse antibody against ICAM3. It can be used for ICAM3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntercellular adhesion molecule 3; ICAM-3; CD antigen CD50; ICAM3
UniProt IDQ28125
Protein RefseqThe length of the protein is 544 amino acids long.
The sequence is show below: MIASGPPPRVYWTSLIFLLLACCLLPTGAQGQTYQVRVEPKDPVVPFGEPLVVNCTLDCPGPGLISLETALSKEPHSRGLGWAAFRLTNVTGDMEILCSGICNKSQVVGFSNITVFGFPKRVELAPLPLWQPVGEELNLSCLVSGGAPRAHLSVVLLRGEEELGRQPLGKEEPAKVTFMVQPRREDHGTNFSCRSELDLRSQGLELFQNTSAPRKLQTYAMPKTAPRLVFPRFWEMETSWPVNCSLNGLFPASEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry