Mouse Anti-Cattle IL1A Antibody (MO-AB-14121R)


Cat: MO-AB-14121R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO14121R
SpecificityThis antibody binds to Cattle IL1A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer''s disease. [provided by RefSeq, Jul 2008]
Product OverviewMouse Anti-Cattle IL1A Antibody is a mouse antibody against IL1A. It can be used for IL1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterleukin-1 alpha; IL-1 alpha; IL1A
UniProt IDP08831
Protein RefseqThe length of the protein is 268 amino acids long.
The sequence is show below: MAKVPDLFEDLKNCYSENEDYSSEIDHLSLNQKSFYDASYEPLREDQMNKFMSLDTSETSKTSKLSFKENVVMVAASGKILKKRRLSLNQFITDDDLEAIANNTEEEIIKPRSAHYSFQSNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry