Mouse Anti-Cattle ITGB1 Antibody (MO-AB-14331R)


Cat: MO-AB-14331R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO14331R
SpecificityThis antibody binds to Cattle ITGB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Endosome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionIntegrin β-1 (ITGB1), also known as CD29, is a cell surface receptor encoded by the ITGB1 gene. The integrin binds to integrin α1 and integrin α2 to form an integrin complex that functions as a collagen receptor. It also forms a dimer with integrin α3, thereby forming integrin receptors for netrin 1 and reelin. These and other integrin β1 complexes have historically been called very late activation (VLA) antigens.Integrin β1 is expressed as at least four different isoforms. In cardiac and skeletal muscles, integrin β-1D isoforms are specifically expressed and located in the ribs, where they contribute to the lateral force transmission from the Z disk to the extracellular matrix. Abnormal levels of integrin β-1D were found in limb-girdle muscular atrophy and polyneuropathy.
Product OverviewMouse Anti-Cattle ITGB1 Antibody is a mouse antibody against ITGB1. It can be used for ITGB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIntegrin beta-1; Fibronectin receptor subunit beta; VLA-4 subunit beta; CD antigen CD29; ITGB1
UniProt IDP53712
Protein RefseqThe length of the protein is 798 amino acids long.
The sequence is show below: MNLQLIFWIGLISSVCCVFGQADENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCHPNDIENPRGSKDIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLVLQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTNEQNCTSPFSYKNVLSLTDKGEVFNELVGKQRISGNLDSPEGGFDAI.
See other products for " ITGB1 "
CBMOAB-45644FYAMouse Anti-Rhesus ITGB1 Antibody (CBMOAB-45644FYA)
MO-AB-35005WMouse Anti-Ferret ITGB1 Antibody (MO-AB-35005W)
MO-AB-20956WMouse Anti-Chimpanzee ITGB1 Antibody (MO-AB-20956W)
MO-AB-15839YMouse Anti-Sheep ITGB1 Antibody (MO-AB-15839Y)
MO-AB-02604YMouse Anti-Chicken ITGB1 Antibody (MO-AB-02604Y)
CBMOAB-00263FYARabbit Anti-Mouse ITGB1 Antibody (CBMOAB-00263FYA)
MO-AB-33325HMouse Anti-Nile tilapia itgb1 Antibody (MO-AB-33325H)
MO-AB-23333HMouse Anti-Mallard ITGB1 Antibody (MO-AB-23333H)
MO-AB-57416WMouse Anti-Marmoset ITGB1 Antibody (MO-AB-57416W)
MO-AB-00678LMouse Anti-Elephant ITGB1 Antibody (MO-AB-00678L)
For Research Use Only | Not For Clinical Use.
Online Inquiry