Mouse Anti-Cattle ITGB1 Antibody (MO-AB-14331R)
Cat: MO-AB-14331R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO14331R |
Specificity | This antibody binds to Cattle ITGB1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Endosome; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Integrin β-1 (ITGB1), also known as CD29, is a cell surface receptor encoded by the ITGB1 gene. The integrin binds to integrin α1 and integrin α2 to form an integrin complex that functions as a collagen receptor. It also forms a dimer with integrin α3, thereby forming integrin receptors for netrin 1 and reelin. These and other integrin β1 complexes have historically been called very late activation (VLA) antigens.Integrin β1 is expressed as at least four different isoforms. In cardiac and skeletal muscles, integrin β-1D isoforms are specifically expressed and located in the ribs, where they contribute to the lateral force transmission from the Z disk to the extracellular matrix. Abnormal levels of integrin β-1D were found in limb-girdle muscular atrophy and polyneuropathy. |
Product Overview | Mouse Anti-Cattle ITGB1 Antibody is a mouse antibody against ITGB1. It can be used for ITGB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Integrin beta-1; Fibronectin receptor subunit beta; VLA-4 subunit beta; CD antigen CD29; ITGB1 |
UniProt ID | P53712 |
Protein Refseq | The length of the protein is 798 amino acids long. The sequence is show below: MNLQLIFWIGLISSVCCVFGQADENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCHPNDIENPRGSKDIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLVLQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTNEQNCTSPFSYKNVLSLTDKGEVFNELVGKQRISGNLDSPEGGFDAI. |
See other products for " itgb1 "
MO-AB-33325H | Mouse Anti-Nile tilapia itgb1 Antibody (MO-AB-33325H) |
MO-AB-20956W | Mouse Anti-Chimpanzee ITGB1 Antibody (MO-AB-20956W) |
MO-AB-06583Y | Mouse Anti-O. anatinus ITGB1 Antibody (MO-AB-06583Y) |
MO-AB-45201W | Mouse Anti-Horse ITGB1 Antibody (MO-AB-45201W) |
MO-AB-08801W | Mouse Anti-Cat ITGB1 Antibody (MO-AB-08801W) |
MO-AB-35005W | Mouse Anti-Ferret ITGB1 Antibody (MO-AB-35005W) |
MO-DKB-03622W | Rabbit Anti-ITGB1 (AA 1-250, clone ms2109-030) Antibody (Cat MO-DKB-03622W) |
MO-AB-08521Y | Mouse Anti-Rabbit ITGB1 Antibody (MO-AB-08521Y) |
MO-AB-26750R | Mouse Anti-Pig ITGB1 Antibody (MO-AB-26750R) |
MO-AB-41894W | Mouse Anti-Guinea pig ITGB1 Antibody (MO-AB-41894W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry