Mouse Anti-Cattle MCM8 Antibody (MO-AB-15465R)


Cat: MO-AB-15465R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15465R
SpecificityThis antibody binds to Cattle MCM8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the mini-chromosome maintenance proteins is a key component of the pre-replication complex and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the mini-chromosome maintenance proteins. The encoded protein may interact with other mini-chromosome maintenance proteins and play a role in DNA replication. This gene may be associated with length of reproductive lifespan and menopause. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Product OverviewMouse Anti-Cattle MCM8 Antibody is a mouse antibody against MCM8. It can be used for MCM8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDNA helicase MCM8; EC 3.6.4.12; Minichromosome maintenance 8; MCM8
UniProt IDE1BPX4
Protein RefseqThe length of the protein is 816 amino acids long.
The sequence is show below: MNGKYRGRGFGQGRFQSWKSGRGGRGFSGKWREREHRPDLNKATGKHPEQTPQSLLLQSTLDHFIPYKGWKLYFSEVYSDSIPFIEKIEAFESFFTERIELYDKDEIERKGSILVDFKELINDDEIIKLIPNIANELRDTPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSRNGETVVNVPHIHARVYNYEPLTQLKNVRANYYGKYIALRGTVVRVSNTKPLCTKMAFLCAACGEIQSLSLPDGKYNLPTK.
For Research Use Only | Not For Clinical Use.
Online Inquiry