AibGenesis™ Mouse Anti-MCRIP1 Antibody (MO-AB-15473R)


Cat: MO-AB-15473R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15473R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO15473R 100 µg
MO-AB-27015H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27015C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO15473R
SpecificityThis antibody binds to Cattle MCRIP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle MCRIP1 Antibody is a mouse antibody against MCRIP1. It can be used for MCRIP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein FAM195B; FAM195B
UniProt IDF1MJJ7
Protein RefseqThe length of the protein is 97 amino acids long.
The sequence is show below: MTSSPVSRVVYNGKRNSSPRSPPNSSEIFTPAHEENVRFIYEAWQGVERDLRSQMSGSERGLVEEYVEKVPNPSLKTFKPIDLSDLKRRNTQDAKKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry