Mouse Anti-Cattle MED24 Antibody (MO-AB-15521R)


Cat: MO-AB-15521R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15521R
SpecificityThis antibody binds to Cattle MED24.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a component of the mediator complex (also known as TRAP, SMCC, DRIP, or ARC), a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activators or nuclear receptors to induce gene expression, possibly by interacting with RNA polymerase II and promoting the formation of a transcriptional pre-initiation complex. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle MED24 Antibody is a mouse antibody against MED24. It can be used for MED24 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator complex subunit 24; MED24
UniProt IDQ2KHX0
Protein RefseqThe length of the protein is 330 amino acids long.
The sequence is show below: MKVVNLKQAILQAWKERWSDYQWAVNMKKFFPKGATWDILNLAEALLEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLTAISKFDDFSRDLCVQALLDIMDMFCDRLSCHGKAEECIGLCRALLSALHWLLRCTAASAERLREGLEAGTPAAGEKQLAMCLQRLEKTLSSTKNRALLHIAKLEEASSWTAIEHCLLKLGEILANLSNHQLRSQAEQCGTLIRSIPTMLSVHSEQLHKTGFPTVHAVVLLEGTMN.
For Research Use Only | Not For Clinical Use.
Online Inquiry