Mouse Anti-Cattle MMS19 Antibody (MO-AB-15883R)


Cat: MO-AB-15883R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15883R
SpecificityThis antibody binds to Cattle MMS19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol; Nucleus; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMMS19 (MMS19 Homolog, Cytosolic Iron-Sulfur Assembly Component) is a Protein Coding gene. Among its related pathways are Metabolism and Cytosolic iron-sulfur cluster assembly. Gene Ontology (GO) annotations related to this gene include binding and protein binding, bridging.
Product OverviewMouse Anti-Cattle MMS19 Antibody is a mouse antibody against MMS19. It can be used for MMS19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMMS19 nucleotide excision repair protein homolog; MMS19-like protein; MMS19
UniProt IDE1BP36
Protein RefseqThe length of the protein is 1030 amino acids long.
The sequence is show below: MAAAAALEAVAPLGTLWGLVQDFVMGQQEGPADQVAADVKSGSYTVLQVVEALGSSLENPEPRTRARGIQLLSQVLLQCHSLLLEKEVVHLILFYENRLKDHHLVIPSVLQGLRALSLCVTLPPGLAVSVLKAIFQEVHVQSLPQVDRHTVYSIITNFMRAREEELKGLGADFTFGFIQVMDGEKDPRNLLVAFHIVYDLISRDYSLGPFVEELFEVTSCYFPIDFTPPPNDPHGIQREDLILSLRAVLASTPRF.
See other products for " mms19 "
CBMOAB-87137FYAMouse Anti-Zebrafish mms19 Antibody (CBMOAB-87137FYA)
MO-AB-59196WMouse Anti-Marmoset MMS19 Antibody (MO-AB-59196W)
MO-AB-10285WMouse Anti-Chimpanzee MMS19 Antibody (MO-AB-10285W)
CBMOAB-24413FYAMouse Anti-D. melanogaster Mms19 Antibody (CBMOAB-24413FYA)
CBMOAB-51547FYAMouse Anti-Rhesus MMS19 Antibody (CBMOAB-51547FYA)
CBMOAB-06700HCBMouse Anti-C. elegans MMS19 Antibody (CBMOAB-06700HCB)
For Research Use Only | Not For Clinical Use.
Online Inquiry