Mouse Anti-Cattle MPP6 Antibody (MO-AB-15943R)


Cat: MO-AB-15943R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15943R
SpecificityThis antibody binds to Cattle MPP6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMembers of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like (see DLG1; MIM 601014), ZO1-like (see TJP1; MIM 601009), p55-like (see MPP1; MIM 305360), and LIN2-like (see CASK; MIM 300172), based on their size and the presence of additional domains. MPP6 is a member of the p55-like MAGUK subfamily (Tseng et al., 2001 [PubMed 11311936]).[supplied by OMIM, Mar 2008]
Product OverviewMouse Anti-Cattle MPP6 Antibody is a mouse antibody against MPP6. It can be used for MPP6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMPP6 protein, Fragment; MPP6
UniProt IDA7E3B6
Protein RefseqThe length of the protein is 308 amino acids long.
The sequence is show below: MQQVLDNLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELVNEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYESPPSSPEMNNSSINNQLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTIIPQQVFVKCHFDYNPYNDNLIPCKEAGLKFSKGEILQIVNRE.
See other products for " MPP6 "
MO-AB-59277WMouse Anti-Marmoset MPP6 Antibody (MO-AB-59277W)
MO-AB-05281HMouse Anti-Frog mpp6 Antibody (MO-AB-05281H)
CBMOAB-02366CRMouse Anti-Yeast MPP6 Antibody (CBMOAB-02366CR)
CBMOAB-51646FYAMouse Anti-Rhesus MPP6 Antibody (CBMOAB-51646FYA)
MO-DKB-01295WRabbit Anti-MPP6 Antibody (MO-DKB-01295W)
MO-DKB-01505WRabbit Anti-MPP6 Antibody (MO-DKB-01505W)
CBMOAB-24527FYAMouse Anti-D. melanogaster Mpp6 Antibody (CBMOAB-24527FYA)
MO-AB-22264WMouse Anti-Chimpanzee MPP6 Antibody (MO-AB-22264W)
For Research Use Only | Not For Clinical Use.
Online Inquiry