Mouse Anti-Cattle MRPL11 Antibody (MO-AB-15983R)


Cat: MO-AB-15983R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15983R
SpecificityThis antibody binds to Cattle MRPL11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis nuclear gene encodes a 39S subunit component of the mitochondial ribosome. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene are found on chromosomes 5 and 12. [provided by RefSeq, May 2014]
Product OverviewMouse Anti-Cattle MRPL11 Antibody is a mouse antibody against MRPL11. It can be used for MRPL11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names39S ribosomal protein L11, mitochondrial; L11mt; MRP-L11; MRPL11
UniProt IDQ2YDI0
Protein RefseqThe length of the protein is 192 amino acids long.
The sequence is show below: MSKLSRATRALRKPEAEGVIRTILRAGQAMPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARNTGKEVAGLVTLKHVYEIARVKAQDDAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERALFLAAQKEADLAAQAEAAKK.
See other products for " MRPL11 "
MO-AB-37693WMouse Anti-Goat MRPL11 Antibody (MO-AB-37693W)
CBMOAB-06799HCBMouse Anti-C. elegans MRPL11 Antibody (CBMOAB-06799HCB)
MO-DKB-01214WRabbit Anti-MRPL11 Antibody (MO-DKB-01214W)
CBMOAB-24681FYAMouse Anti-D. melanogaster Mrpl11 Antibody (CBMOAB-24681FYA)
MO-AB-24012WMouse Anti-Chimpanzee MRPL11 Antibody (MO-AB-24012W)
CBMOAB-51704FYAMouse Anti-Rhesus MRPL11 Antibody (CBMOAB-51704FYA)
CBMOAB-02394CRMouse Anti-Yeast MRPL11 Antibody (CBMOAB-02394CR)
MO-AB-27187HMouse Anti-Rat Mrpl11 Antibody (MO-AB-27187H)
CBMOAB-87352FYAMouse Anti-Zebrafish mrpl11 Antibody (CBMOAB-87352FYA)
CBMOAB-36703FYCMouse Anti-Arabidopsis MRPL11 Antibody (CBMOAB-36703FYC)
For Research Use Only | Not For Clinical Use.
Online Inquiry