Mouse Anti-Cattle MRPL28 Antibody (MO-AB-16002R)


Cat: MO-AB-16002R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO16002R
SpecificityThis antibody binds to Cattle MRPL28.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein, a part of which was originally isolated by its ability to recognize tyrosinase in an HLA-A24-restricted fashion.
Product OverviewMouse Anti-Cattle MRPL28 Antibody is a mouse antibody against MRPL28. It can be used for MRPL28 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names39S ribosomal protein L28, mitochondrial; MRPL28
UniProt IDM5FMT5
Protein RefseqThe length of the protein is 256 amino acids long.
The sequence is show below: MPLHKVPVGLWKRLRLREGIYSRLPAHYLRSLEEARTPTPVHFRPHGAKFKINPKNGQRERVEDVPIPVHYPPESQLGLWGGEGWLKGHRYVNNDKFSKRVKKVWKPQLFQRELYSEILDTRFTVTVTMRTLDLIDEAYGFDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPDDPERRAAIYDKYKAFVIPEAEAEWVGLTLDEAVEKQRLLEEKDPVPLFKVYVEELVEQLQQQALSEPAVVQKRANRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry