Mouse Anti-Cattle MRPS31 Antibody (MO-AB-16067R)


Cat: MO-AB-16067R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO16067R
SpecificityThis antibody binds to Cattle MRPS31.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. The 28S subunit of the mammalian mitoribosome may play a crucial and characteristic role in translation initiation. This gene encodes a 28S subunit protein that has also been associated with type 1 diabetes; however, its relationship to the etiology of this disease remains to be clarified. Pseudogenes corresponding to this gene have been found on chromosomes 3 and 13.
Product OverviewMouse Anti-Cattle MRPS31 Antibody is a mouse antibody against MRPS31. It can be used for MRPS31 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names28S ribosomal protein S31, mitochondrial; MRP-S31; S31mt; MRPS31
UniProt IDP82925
Protein RefseqThe length of the protein is 386 amino acids long.
The sequence is show below: MFPRVSAVLPFRPLSRLPLCSAGPEASAATVVPLASPHGTVRTKCNIQRYFGTNSVIYSKKDDKSVPACEISKETENQGSTKENKKKDLVNIIKGMKVELSTVNVQTTKPPNRGQLKSLEAAIRRLQKSPEDAPQKSKSLSPELVAAATAVADSLPFDKQTTKSELLRQLRQHEEDSKAQKDGEKPKISFSNIISDMKVARSSTARASTRPVHQIQFDEGADDFVDREETADLRKRFRKNIFKGKRLNIFELKPV.
For Research Use Only | Not For Clinical Use.
Online Inquiry