Mouse Anti-Cattle MST1 Antibody (MO-AB-16108R)


Cat: MO-AB-16108R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO16108R
SpecificityThis antibody binds to Cattle MST1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The receptor for this protein is RON tyrosine kinase, which upon activation stimulates ciliary motility of ciliated epithelial lung cells. This protein is secreted and cleaved to form an alpha chain and a beta chain bridged by disulfide bonds.
Product OverviewMouse Anti-Cattle MST1 Antibody is a mouse antibody against MST1. It can be used for MST1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHepatocyte growth factor-like protein; MST1
UniProt IDE1BDW7
Protein RefseqThe length of the protein is 712 amino acids long.
The sequence is show below: MGWLPLLLLLIWFSGAPGQRSPLNDFQVLRGTELQHLLHSVGPGPWQEDVANAEECAGLCGPLLDCRAFHYNLSSHGCQLLPWTQHSPHTRLQRSGRCDLFQKKNYVRTCIVDNGVEYRGTVAITVGGLPCQRWSHRFPNDHKFTPTLRNGLEENFCRNPDRDPGGPWCYTTDPAVRFQSCGIKSCREATCLWCNGEDYRGSVDSTESGRECQRWDLQHPHPHPFEPGFWTKIWTTTIAGIRTARSGPGAIPPTR.
For Research Use Only | Not For Clinical Use.
Online Inquiry