Mouse Anti-Cattle MT1A Antibody (MO-AB-16119R)
Cat: MO-AB-16119R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO16119R |
Specificity | This antibody binds to Cattle MT1A. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions. The conserved cysteine residues co-ordinate metal ions using mercaptide linkages. These proteins act as anti-oxidants, protect against hydroxyl free radicals, are important in homeostatic control of metal in the cell, and play a role in detoxification of heavy metals. Disruption of two metallothionein genes in mouse resulted in defects in protection against heavy metals, oxidative stress, immune reactions, carcinogens, and displayed obesity. |
Product Overview | Mouse Anti-Cattle MT1A Antibody is a mouse antibody against MT1A. It can be used for MT1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Metallothionein-1A; MT-1A; MTC; Metallothionein-IA; MT-IA; MT1A; MT-IA |
UniProt ID | P67983 |
Protein Refseq | The length of the protein is 61 amino acids long. The sequence is show below: MDPNCSCPTGGSCSCAGSCTCKACRCPSCKKSCCSCCPVGCAKCAQGCVCKGASDKCSCCA. |
See other products for " MT1A "
CBMOAB-34735FYB | Mouse Anti-Rice MT1A Antibody (CBMOAB-34735FYB) |
CBMOAB-36773FYC | Mouse Anti-Arabidopsis MT1A Antibody (CBMOAB-36773FYC) |
MO-AB-15163W | Mouse Anti-Chimpanzee MT1A Antibody (MO-AB-15163W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry