Mouse Anti-Cattle NAB2 Antibody (MO-AB-16355R)


Cat: MO-AB-16355R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO16355R
SpecificityThis antibody binds to Cattle NAB2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
Product OverviewMouse Anti-Cattle NAB2 Antibody is a mouse antibody against NAB2. It can be used for NAB2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNGFI-A binding protein 2; EGR1 binding protein 2; NAB2
UniProt IDQ1RMU0
Protein RefseqThe length of the protein is 525 amino acids long.
The sequence is show below: MHRAASPTAEQPPGGGDSARRTPQPRLKPSSRAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSPPFSPPAGGGGPEGTGAGGLAAAGTGGGPDRLEPEMVRMVVESVERIFRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry