Mouse Anti-Cattle NFE2L2 Antibody (MO-AB-16685R)


Cat: MO-AB-16685R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO16685R
SpecificityThis antibody binds to Cattle NFE2L2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a transcription factor which is a member of a small family of basic leucine zipper (bZIP) proteins. The encoded transcription factor regulates genes which contain antioxidant response elements (ARE) in their promoters; many of these genes encode proteins involved in response to injury and inflammation which includes the production of free radicals. Multiple transcript variants encoding different isoforms have been characterized for this gene. [provided by RefSeq, Sep 2015]
Product OverviewThis product is a mouse antibody against NFE2L2. It can be used for NFE2L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNuclear factor (Erythroid-derived 2)-like 2; NFE2L2
UniProt IDA5D975
Protein RefseqThe length of the protein is 607 amino acids long.
The sequence is show below: MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRQKEHELEKQKKLEKERQEQLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIPSETSGSANYSQVAPIPKADDLYFDDCMQLLAETFPFVDDNEVSSATFQSLVPDIPSHIESPVFTAPPQAQSPETLIVQVATAVLDDMQDIEQVWEELLSIPELQCLNIQNDKLAETSTVPSPETKLTEIDNYHFYSSMPSLDKEVGNCSPHFLNAFEDSFNS.
For Research Use Only | Not For Clinical Use.
Online Inquiry