Mouse Anti-Cattle NOV Antibody (MO-AB-16860R)
Cat: MO-AB-16860R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO16860R |
Specificity | This antibody binds to Cattle NOV. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. |
Product Overview | This product is a mouse antibody against NOV. It can be used for NOV detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Nephroblastoma overexpressed protein, Fragment; NOV |
UniProt ID | O97574 |
Protein Refseq | The length of the protein is 58 amino acids long. The sequence is show below: YRTEATLGVAVSDSSINCIEQTTEWSACSKSCGMGFSTRVTNRNPHCEMVKQTRLCMV. |
See other products for " NOV "
CBMOAB-37462FYC | Mouse Anti-Arabidopsis NOV Antibody (CBMOAB-37462FYC) |
MO-AB-22353W | Mouse Anti-Chimpanzee NOV Antibody (MO-AB-22353W) |
MO-AB-03190Y | Mouse Anti-Chicken NOV Antibody (MO-AB-03190Y) |
CBMOAB-52860FYA | Mouse Anti-Rhesus NOV Antibody (CBMOAB-52860FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry