Mouse Anti-Cattle NUP133 Antibody (MO-AB-17042R)


Cat: MO-AB-17042R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO17042R
SpecificityThis antibody binds to Cattle NUP133.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. The nucleoporin protein encoded by this gene displays evolutionarily conserved interactions with other nucleoporins. This protein, which localizes to both sides of the nuclear pore complex at interphase, remains associated with the complex during mitosis and is targeted at early stages to the reforming nuclear envelope. This protein also localizes to kinetochores of mitotic cells.
Product OverviewThis product is a mouse antibody against NUP133. It can be used for NUP133 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNucleoporin 133kDa; NUP133
UniProt IDQ08DW6
Protein RefseqThe length of the protein is 1156 amino acids long.
The sequence is show below: MFPAVSSPRTPGTGTRRGPLGGVGPGSTPRATSRKGLTLGSSLSSPVLFSPAGRRSSLSSRGTPTRIFPHHSITESVNYDVKTFGSSLPVKVIEALTLTEVDDQLTVHIDEGGWACLVCKEKLIIWKIALSPITKLSVCKELQLPPSDFHWSADLVALSYSATSGEAHSTQAVTVMVATREGSIRYWPSLASEDTYTETFIDLGGDKTYSFLTAVQGGSFILSSSGGQLIRLIPESIGKIHQHILPQGQGVLSGI.
For Research Use Only | Not For Clinical Use.
Online Inquiry