Mouse Anti-Cattle NUP35 Antibody (MO-AB-17046R)


Cat: MO-AB-17046R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO17046R
SpecificityThis antibody binds to Cattle NUP35.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the nucleoporin family. The encoded protein contains two membrane binding regions, is localized to the nuclear rim, and is part of the nuclear pore complex. All molecules entering or leaving the nucleus either diffuse through or are actively transported by the nuclear pore complex. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 7 and 10.
Product OverviewThis product is a mouse antibody against NUP35. It can be used for NUP35 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNucleoporin NUP53; NUP35
UniProt IDA5PJI3
Protein RefseqThe length of the protein is 327 amino acids long.
The sequence is show below: MAAFAVEPQAPTLGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISSPSIGVMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQANISVMQSPLVGVVTTTPGTGQSVFSPANIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDTWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKSVMENSDR.
See other products for " NUP35 "
MO-AB-35205WMouse Anti-Ferret NUP35 Antibody (MO-AB-35205W)
MO-AB-09004YMouse Anti-Rabbit NUP35 Antibody (MO-AB-09004Y)
MO-AB-05831HMouse Anti-Frog nup35 Antibody (MO-AB-05831H)
MO-AB-02758YMouse Anti-Chicken NUP35 Antibody (MO-AB-02758Y)
MO-DKB-03192WRabbit Anti-NUP35 (AA 280-330) Antibody (Cat MO-DKB-03192W)
MO-AB-42180WMouse Anti-Guinea pig NUP35 Antibody (MO-AB-42180W)
MO-AB-16379YMouse Anti-Sheep NUP35 Antibody (MO-AB-16379Y)
MO-AB-08111WMouse Anti-Cat NUP35 Antibody (MO-AB-08111W)
MO-AB-02895WMouse Anti-Fruit fly Nup35 Antibody (MO-AB-02895W)
MO-AB-33510HMouse Anti-Nile tilapia nup35 Antibody (MO-AB-33510H)
For Research Use Only | Not For Clinical Use.
Online Inquiry