Mouse Anti-Cattle NUP58 Antibody (MO-AB-17051R)


Cat: MO-AB-17051R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO17051R
SpecificityThis antibody binds to Cattle NUP58.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the nucleoporin family that shares 87% sequence identity with rat nucleoporin p58. The protein is localized to the nuclear rim and is a component of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product OverviewThis product is a mouse antibody against NUP58. It can be used for NUP58 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNUPL1 protein; NUPL1
UniProt IDA5D7B3
Protein RefseqThe length of the protein is 586 amino acids long.
The sequence is show below: MSTGFSFGSSTLGSSTVAAGGSSTGGGFSFGTGTSSNPTVGLNFGTLGSTATPATTSASGGFGTSLFGSKPATGFTLGGTTTGTAATTSASTIGFSLGFSKPAASATPFALPIASTSASSLTLSSALTSTPAASTGFTLNNLSGTAATTTTASTGLSLGGALTGLGGSLFQGTSTASSGLGQSALGLTLGTTAATSAAGNEGLGGIDFSSSSDKKSDKTGTRPEDSKALKDETLPAVICQDVDNLQKFVKEQKQV.
For Research Use Only | Not For Clinical Use.
Online Inquiry