Mouse Anti-Cattle OR2V1 Antibody (MO-AB-17234R)


Cat: MO-AB-17234R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO17234R
SpecificityThis antibody binds to Cattle OR2V1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Product OverviewThis product is a mouse antibody against OR2V1. It can be used for OR2V1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOlfactory receptor; OR2V1
UniProt IDG3N3N9
Protein RefseqThe length of the protein is 315 amino acids long.
The sequence is show below: MGIWLNQSSIDGFILLGIFSHSQADFALFSVVMVVFTVALCGNVLLVCLIYMDPRLRTPMYFFLSQLSLMDLLLVCDIVPKMAFNFLSGRKFISFVGCAIQIGFFVSLVGSEGLLLGLMAYDRYVAISHPLHYPILMSQKVCLQIAGSSWTFGIIDGMIQMVGAISLPYCGPRNVDHFFCEVPALLKLACVDTSIFDSLLFACCIFMLLLPFSIIVASYARILGAVLHMHSAHARKKALATCSSHLTAVSLFYGA.
See other products for " OR2V1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry