AibGenesis™ Mouse Anti-PAR-3 Antibody (MO-AB-17546R)


Cat: MO-AB-17546R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-17546R Monoclonal Cattle (Bos taurus), C. elegans (Caenorhabditis elegans) WB, ELISA MO17546R 100 µg
MO-NAB-00585W Monoclonal C. elegans (Caenorhabditis elegans) IA NW0507 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), C. elegans (Caenorhabditis elegans)
CloneMO17546R
SpecificityThis antibody binds to Cattle PAR-3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against PAR-3. It can be used for PAR-3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPartitioning-defective 3 protein, Fragment; PAR-3
UniProt IDQ4QZ15
Protein RefseqThe length of the protein is 120 amino acids long.
The sequence is show below: GKAEQENLFHENDCIVRINDGDLRNRRFEQAQHMFRQAMRTSIIWFHVVPAANKEQYEQLSQSERNNYYSSRFSPDSQHVDHRGVTSAGPQALPRASRLNPPPEHADPHPRLLPHSAHAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry