Mouse Anti-Cattle RCE1 Antibody (MO-AB-19148R)


Cat: MO-AB-19148R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO19148R
SpecificityThis antibody binds to Cattle RCE1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAssembly factor that plays a role in the assembly of the respiratory chain supercomplexes (SCs) composed of ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV). Involved in the recruitment of COX13 and RCF2 into cytochrome c oxidase. May also be required for late-stage assembly of the COX12 and COX13 subunits (PubMed:22342701, PubMed:22405070, PubMed:22310663). Required for the generation and maintenance of a normal proton motive force (PMF) across the inner mitochondrial membrane (IMM) by preventing proton leakage through an inactive population of CIV that accumulates when RCF1 and/or RCF2 proteins are absent (PubMed:30683696, PubMed:31591265).
Product OverviewThis product is a mouse antibody against RCE1. It can be used for RCE1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCAAX prenyl protease 2; EC 3.4.22.-; Farnesylated proteins-converting enzyme 2; FACE-2; Prenyl protein-specific endoprotease 2; RCE1 homolog; RCE1
UniProt IDA6H7A0
Protein RefseqThe length of the protein is 308 amino acids long.
The sequence is show below: MAALGGDGFRLLSVSRPERQPESAALGGPGPGLCCWVSVFSCLSLACSYVGSLYVWKSELPRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCTGLGPAVFTCPLFFGVAHFHHIFEQLRFRQSSVGSIFLSAGHLIGPVLCHSFCNYMGFPAVCAAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry