Mouse Anti-Cattle REV1 Antibody (MO-AB-19215R)


Cat: MO-AB-19215R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO19215R
SpecificityThis antibody binds to Cattle REV1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDeoxycytidyl transferase involved in DNA repair. Transfers a dCMP residue from dCTP to the 3''-end of a DNA primer in a template-dependent reaction. May assist in the first step in the bypass of abasic lesions by the insertion of a nucleotide opposite the lesion. Required for normal induction of mutations by physical and chemical agents. Involved in mitochondrial DNA mutagenesis.
Product OverviewThis product is a mouse antibody against REV1. It can be used for REV1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesREV1 protein; REV1
UniProt IDA5PK25
Protein RefseqThe length of the protein is 433 amino acids long.
The sequence is show below: MRRGGWRKRAEDDWEKWGGYMAAKVQKLEQQFRSDAAIQKDGTSSTIFSGVAIYVNGYTDPSAEELRKLMMLHGGQYHVYYSRSKTTHIIATNLPNAKIKELKGEKVIRPEWIVESIKAGRLLSCIPYQLYSKPSSVQKSLNFNPVCKPEDPLPGPSSITKQLNDRVNHIIKKIETESEVRVNGVNNWNEEAADNDFDFVGLEPVFPGRKQNGIPHPRGGRALCNGHAHSSHGALKSLDCLAPPGSGVASRLSPE.
See other products for " REV1 "
CBMOAB-03337CRMouse Anti-Yeast REV1 Antibody (CBMOAB-03337CR)
MO-AB-03793YMouse Anti-Chicken REV1 Antibody (MO-AB-03793Y)
CBMOAB-09062HCBMouse Anti-C. elegans REV1 Antibody (CBMOAB-09062HCB)
CBMOAB-29376FYAMouse Anti-D. melanogaster Rev1 Antibody (CBMOAB-29376FYA)
CBMOAB-95722FYAMouse Anti-Zebrafish rev1 Antibody (CBMOAB-95722FYA)
MO-AB-22884WMouse Anti-Chimpanzee REV1 Antibody (MO-AB-22884W)
MO-AB-63199WMouse Anti-Marmoset REV1 Antibody (MO-AB-63199W)
MO-AB-07052HMouse Anti-Frog rev1 Antibody (MO-AB-07052H)
MO-AB-05613WMouse Anti-Rhesus REV1 Antibody (MO-AB-05613W)
CBMOAB-39987FYCMouse Anti-Arabidopsis REV1 Antibody (CBMOAB-39987FYC)
For Research Use Only | Not For Clinical Use.
Online Inquiry