Mouse Anti-Cattle RSPO1 Antibody (MO-AB-19631R)


Cat: MO-AB-19631R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO19631R
SpecificityThis antibody binds to Cattle RSPO1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a secreted activator protein with two cysteine-rich, furin-like domains and one thrombospondin type 1 domain. The encoded protein is a ligand for leucine-rich repeat-containing G-protein coupled receptors (LGR proteins) and positively regulates the Wnt signaling pathway. In mice, the protein induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced adverse effects. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against RSPO1. It can be used for RSPO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRSPO1 protein; RSPO1
UniProt IDA7YY21
Protein RefseqThe length of the protein is 262 amino acids long.
The sequence is show below: MRLGLCVVALVLSWMHLAAGSRGIKGKRQRRISADGGQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQESLYLHKGRCYPACPEGSAPADGTMECSSPAQCEMSEWSLWGPCSKKKKLCGFRRGLEERTRRVLHAPGGDHAVCSDTKETRKCTVRRTPCPEGQKRRKGSQGRRENANRNPGHKESKEAGTGARRRKGQQQQQQGTEGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry