Mouse Anti-Cattle SCAP Antibody (MO-AB-19761R)


Cat: MO-AB-19761R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO19761R
SpecificityThis antibody binds to Cattle SCAP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Golgi apparatus; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein with a sterol sensing domain (SSD) and seven WD domains. In the presence of cholesterol, this protein binds to sterol regulatory element binding proteins (SREBPs) and mediates their transport from the ER to the Golgi. The SREBPs are then proteolytically cleaved and regulate sterol biosynthesis. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against SCAP. It can be used for SCAP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSterol regulatory element-binding protein cleavage-activating protein; SCAP; SREBP cleavage-activating protein; SCAP
UniProt IDA6QM06
Protein RefseqThe length of the protein is 1278 amino acids long.
The sequence is show below: MTLTERLREKISQAFYNHGLFCASYPIPIILFTGLCILACCYPLLKLPLPGTGPVEFTTPVKDYSPPPLTSDHKPGEPNEQPEWYVGAPVAYIQQIFVKSSVSPWHKNLLAVDVFRSPLSRAFQLVEEIRNHVLKDSSGTRSLEDVCLQVTDLLPGLRKLRNLLPEHGCLLLSPGNFWQNDRERFHADPDIIRTIHQHEPKTLQTSATLKDLLFGVPGKYSGVSLYTRKRLVSYTITLVFQHYHAKFLGSLRARL.
For Research Use Only | Not For Clinical Use.
Online Inquiry