Mouse Anti-Cattle SLC5A11 Antibody (MO-AB-20459R)


Cat: MO-AB-20459R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO20459R
SpecificityThis antibody binds to Cattle SLC5A11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInvolved in the sodium-dependent cotransport of myo-inositol (MI) with a Na:MI stoichiometry of 2:1. Exclusively responsible for apical MI transport and absorption in intestine. Also can transport D-chiro-inositol (DCI) but not L-fructose. Exhibits stereospecific cotransport of both D-glucose and D-xylose. May induce apoptosis through the TNF-alpha, PDCD1 pathway. May play a role in the regulation of MI concentration in serum, involving reabsorption in at least the proximal tubule of the kidney.
Product OverviewThis product is a mouse antibody against SLC5A11. It can be used for SLC5A11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSodium/myo-inositol cotransporter 2; Na(+)/myo-inositol cotransporter 2; Sodium/myo-inositol transporter 2; SMIT2; Solute carrier family 5 member 11; SLC5A11; SMIT2
UniProt IDQ3ZC26
Protein RefseqThe length of the protein is 674 amino acids long.
The sequence is show below: MESSASSPPLTQSDPLEAFPRRTLEAGDIAVLVLYFLFVLAVGLWSTVKTKRDTVKGYFLAGGNMLWWPVGASLFASNVGSGHFVGLAGSGAAAGLSVTAYELNGLFFVLMLSWIFLPIYITGQVTTMPEYLRKRFGGNRIPIILAVLYLFIYIFTKISVDMYAGAIFIQQSLHVNLYLAIVGLLAVTALYTIAGGLAAVIYTDALQTLIMLIGALILMGYSFAAVGGLEGLEEKYFLAMASNRSGNSSCGLPRE.
For Research Use Only | Not For Clinical Use.
Online Inquiry