Mouse Anti-Cattle STAT3 Antibody (MO-AB-21006R)


Cat: MO-AB-21006R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO21006R
SpecificityThis antibody binds to Cattle STAT3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Plasma membrane; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSignal transducer and activator of transcription that mediates cellular responses to interleukins, KITLG/SCF, and other growth factors. Mediates cellular responses to activated FGFR1, FGFR2, FGFR3, and FGFR4. Promoters with various acute phase protein genes. Activated by IL31 via IL31RA. Cytoplasmic STAT3 inhibits macroautophagy by inhibiting EIF2AK2/PKR activity. The lectin REG3G plays an important role in host defense against methicillin-resistant Staphylococcus aureus pulmonary infection by regulating the expression of antimicrobials.
Product OverviewThis product is a mouse antibody against STAT3. It can be used for STAT3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSignal transducer and activator of transcription 3; STAT3
UniProt IDP61635
Protein RefseqThe length of the protein is 770 amino acids long.
The sequence is show below: MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQLLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLLDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry