AibGenesis™ Mouse Anti-TMEM114 Antibody (MO-AB-21763R)


Cat: MO-AB-21763R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-21763R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO21763R 100 µg
Inquiry
MO-AB-29521H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29521C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO21763R
SpecificityThis antibody binds to Cattle TMEM114.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a glycosylated transmembrane protein that plays a role in lens and eye development. Mutations in this gene, including a t(16;22)(p13.3;q11.2) translocation, are associated with congenital and juvenile cataract disorders. Alternative splicing of this gene results in multiple transcript variants. (From NCBI)
Product OverviewThis product is a mouse antibody against TMEM114. It can be used for TMEM114 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 114-like; TMEM114
UniProt IDE1B9W1
Protein RefseqThe length of the protein is 223 amino acids long.
The sequence is show below: MRVHLGALAGAAALTGALSFVLLAAAIGTDFWYIIDTERLERGGPGARGPVGANNRSQLEPLSSHSGLWRTCRVQSPCAPLMNPFWQENVTVSDSSRQLLTMHGTFVILLPLSLILMVFGGMTGFLSFLLRASCLLLLTGTLFLFGALVTLAGISVYIAYSAAAFQEALCLLQEKTLLDQVDIRFGWSLALGWVSCVAELLTGATFLVAARVLSLRRRQDQAI.
For Research Use Only | Not For Clinical Use.
Online Inquiry