Mouse Anti-Cattle TOP1 Antibody (MO-AB-22041R)


Cat: MO-AB-22041R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO22041R
SpecificityThis antibody binds to Cattle TOP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionReleases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(3''-phosphotyrosyl)-enzyme intermediate and the expulsion of a 5''-OH DNA strand. The free DNA strand then rotates around the intact phosphodiester bond on the opposing strand, thus removing DNA supercoils. Finally, in the religation step, the DNA 5''-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone (By similarity).
Product OverviewThis product is a mouse antibody against TOP1. It can be used for TOP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTOP1 protein, Fragment; TOP1
UniProt IDQ17QA9
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKDKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKIKASGDAKIKKEKENGFSSPPRIKDEPEDDGYFAPPKEDIKPLKRPRDEDDADYKPKKIKTEDIKKEKKRKLEEEEDGKLKKPKNKDKDKDKKVPEPDSKKKKK.
See other products for " TOP1 "
MO-AB-23689WMouse Anti-Chimpanzee TOP1 Antibody (MO-AB-23689W)
MO-AB-66692WMouse Anti-Marmoset TOP1 Antibody (MO-AB-66692W)
CBMOAB-45190FYCMouse Anti-Arabidopsis TOP1 Antibody (CBMOAB-45190FYC)
CBMOAB-60839FYAMouse Anti-Rhesus TOP1 Antibody (CBMOAB-60839FYA)
CBMOAB-12264HCBMouse Anti-C. elegans TOP1 Antibody (CBMOAB-12264HCB)
MO-AB-43483WMouse Anti-Hamsters TOP1 Antibody (MO-AB-43483W)
CBMOAB-04548CRMouse Anti-Yeast TOP1 Antibody (CBMOAB-04548CR)
CBMOAB-10364FYBMouse Anti-Zebrafish top1 Antibody (CBMOAB-10364FYB)
CBMOAB-33186FYAMouse Anti-D. melanogaster Top1 Antibody (CBMOAB-33186FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry