Mouse Anti-Cattle TPX2 Antibody (MO-AB-22094R)


Cat: MO-AB-22094R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO22094R
SpecificityThis antibody binds to Cattle TPX2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTPX2 (TPX2, Microtubule Nucleation Factor) is a Protein Coding gene. Diseases associated with TPX2 include Uterine Corpus Endometrial Carcinoma and Hepatocellular Carcinoma. Among its related pathways are Gene Expression and Regulation of TP53 Activity. Gene Ontology (GO) annotations related to this gene include GTP binding and protein kinase binding.
Product OverviewThis product is a mouse antibody against TPX2. It can be used for TPX2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTargeting protein for Xklp2; TPX2
UniProt IDF1MJB6
Protein RefseqThe length of the protein is 704 amino acids long.
The sequence is show below: MSQVTTSYSYDAPTDFINFSSLTDEEDTQHIDSWFDEKANLENKFTGKDGTGGLYQGKTPLRKANLHRDVTPLRPVDNTYNKQAEKENLVEESIPSNECPSMKVKETTSRNNPVQPQRRSLRLSAKKNLEQKEKQHVKMKAKRCGTPVIINEFPPSKKMKVQKILKSTEEQELEKRMKMQQEVVEMRKRNEEFKKFALAGAGQPVKKSVSQVTKAVDFHFRTDERVKQHSKNQEEYKEVNFTSELRKHPPSPARV.
See other products for " TPX2 "
MO-AB-35503HMouse Anti-Tomato TPX2 Antibody (MO-AB-35503H)
MO-AB-66787WMouse Anti-Marmoset TPX2 Antibody (MO-AB-66787W)
CBMOAB-10555FYBMouse Anti-Zebrafish tpx2 Antibody (CBMOAB-10555FYB)
MO-AB-24413WMouse Anti-Chimpanzee TPX2 Antibody (MO-AB-24413W)
CBMOAB-45286FYCMouse Anti-Arabidopsis TPX2 Antibody (CBMOAB-45286FYC)
MO-AB-06679WMouse Anti-Rhesus TPX2 Antibody (MO-AB-06679W)
MO-AB-06089YMouse Anti-A. aegpti TPX2 Antibody (MO-AB-06089Y)
MO-AB-17388HMouse Anti-Malaria parasite tpx2 Antibody (MO-AB-17388H)
CBMOAB-60963FYAMouse Anti-Rhesus TPX2 Antibody (CBMOAB-60963FYA)
MO-AB-00950HMouse Anti-Arabidopsis TPX2 Antibody (MO-AB-00950H)
For Research Use Only | Not For Clinical Use.
Online Inquiry