Mouse Anti-Cattle TTF2 Antibody (MO-AB-22353R)


Cat: MO-AB-22353R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO22353R
SpecificityThis antibody binds to Cattle TTF2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the SWI2/SNF2 family of proteins, which play a critical role in altering protein-DNA interactions. The encoded protein has been shown to have dsDNA-dependent ATPase activity and RNA polymerase II termination activity. This protein interacts with cell division cycle 5-like, associates with human splicing complexes, and plays a role in pre-mRNA splicing.
Product OverviewThis product is a mouse antibody against TTF2. It can be used for TTF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription termination factor, RNA polymerase II; TTF2
UniProt IDQ05B68
Protein RefseqThe length of the protein is 1163 amino acids long.
The sequence is show below: MEVVRCPEHGTLCLLKTGVREGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVELQGLSLSQGKKEYRLFFRCVKSKAEGKQWCGNIPWQDPNSKEHSGASKSQLASEPSHYPSSHQRNPFKVLDKNQEPSVWKQFIKGEDEEKTADKKQREKGDPLLDPKKEQKPESKCWTEKELSSGLGVKKKQSAIQDKQQREKTEFQCEAKEIEGMHKRNLLEMKSKQVRGNVLREPSAFQVKSDSESHSVQKESE.
For Research Use Only | Not For Clinical Use.
Online Inquiry