Mouse Anti-Cattle UPB1 Antibody (MO-AB-22612R)


Cat: MO-AB-22612R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO22612R
SpecificityThis antibody binds to Cattle UPB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway. The pyrimidine bases uracil and thymine are degraded via the consecutive action of dihydropyrimidine dehydrogenase (DHPDH), dihydropyrimidinase (DHP) and beta-ureidopropionase (UP) to beta-alanine and beta-aminoisobutyric acid, respectively. UP deficiencies are associated with N-carbamyl-beta-amino aciduria and may lead to abnormalities in neurological activity.
Product OverviewThis product is a mouse antibody against UPB1. It can be used for UPB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUPB1 protein; UPB1
UniProt IDA7MBE8
Protein RefseqThe length of the protein is 384 amino acids long.
The sequence is show below: MAGSGFESLEQCLEKHLPLAELQEVKRLLYGKETRKLDLPGAALEAASRGDFELQGYAFEAAAEQQRRPRTVRVGLVQNRTPLPADTPVVKQVTALHRRMEAVVEVAAMCGVNIICFQEAWTMPFAFCTREKLPWTEFAESAEDGPTIKFCQELARKHGMVVVSPVLERDSDHGDVLWNTAVVVASSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYSINGAEIIFN.
For Research Use Only | Not For Clinical Use.
Online Inquiry